PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v2976880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 348aa    MW: 40045.3 Da    PI: 9.248
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v2976880.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.51.9e-073153481950
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqN 50 
                      Fe   ++yps  ++  LA+++gL+ +qV++WF N
  Lj4g3v2976880.1 315 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFIN 348
                      664459**************************88 PP

2BELL1041.1e-33177247272
             BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      + elqk+k+kL s+leeV++r+++y++q+++v+ssFeavag g+a++Y +lAlk++S+hFrc k  + eqi
  Lj4g3v2976880.1 177 FVELQKRKTKLFSMLEEVERRHRHYCNQMKAVVSSFEAVAGNGAATVYSALALKQMSKHFRCFKGGVLEQI 247
                      679******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.1E-45118245IPR006563POX domain
PfamPF075267.1E-40123242IPR006563POX domain
PROSITE profilePS5007110.835293348IPR001356Homeobox domain
CDDcd000863.68E-8296348No hitNo description
SuperFamilySSF466891.8E-12297348IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-20299348IPR009057Homeodomain-like
PfamPF059206.0E-15313348IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGENKSRDMV SSSTGMDMIG FSKNLHLHHQ QQQQEENHLI QDSSSPWQNN SRFLVDDSSL  60
RCVFPCEGNE RPSQGLSLSL SSTNPSSIGL QPFELRHTNQ HHHHHQQQML QDANIYHQHG  120
DFVLKHSKFL VPAQDLLNEL CSLGTKKNDI PKSEKSEKNK EWEEGSSKKH CLGSLEFVEL  180
QKRKTKLFSM LEEVERRHRH YCNQMKAVVS SFEAVAGNGA ATVYSALALK QMSKHFRCFK  240
GGVLEQIHAT RKLLGEKDPI SPGTTKGETP RLRIIEQTLR QQRAFQQMNM METHPWRPQR  300
GLPERSVSVL RAWLFEHFLH PYPSDVDKHI LARQTGLSRS QVSNWFIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510083.11e-163PREDICTED: homeobox protein BEL1 homolog
RefseqXP_014510084.11e-163PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388973e-92BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A0L9VPZ51e-162A0A0L9VPZ5_PHAAN; Uncharacterized protein
STRINGPOPTR_0001s09720.11e-159(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.22e-83BEL1-like homeodomain 2